Saturday, March 7, 2020
Creation Paper
Creation Paper Creation Paper Creation Paper: Develop Your Creative Skills There may be different situations when you have to write a creation paper as well as there may be different kinds of creation papers. But the main issue you should understand is the purpose of such papers. If you get the point, it will be easier for you to write a creation paper. Purpose of Creation Paper Writing Actually, creative writing is a special kind of writing. Creation papers are called not to convince, argue, prove or research but to develop an idea, first of all. A creation paper is personal writing. That means that you should express your own ideas, thoughts and emotions concerning a certain issue in such a paper. Thus, all that you need in writing of such a paper is your thinking and creative skills the ability to ponder a problem and generate ideas. Process of Writing Interesting Creation Paper So, you have a topic that you are going to write your creation paper on and you have something to say about this topic. What s hould you do? Lets try to point out the main steps that you should take in order to join all your ideas about a topic into a good creation paper!Put down all the ideas that come to your mind. Do not be afraid if you have got a chaotic picture. You are working at a paper draft. So, it is quite usual! Point the main idea that you would like to develop in your creation paper. All other ideas should be bound with the main one and support it. Make an outline on the basis of your notes. Do not forget your creation paper like any other kind of writing should be well-organized. So, split it into several interrelated parts. As a rule, they are introduction, main body and conclusion. Write your paper keeping in mind your outline. Secrets of Successful Creation Paper When writing your creation paper pay attention to the following:Any paper should grab the interest of the reader. Otherwise, what is it written for? You should catch the interest of your reader from the very begi nning. So, make the introduction of your paper as interest as possible. You may use questions or some exclamatory phrases, it is up to you! Of course, you put forward no theories, suggest no arguments and make no research in your creation paper. But it also should have some logical ending. So, there should be a final part containing 1 or 2 sentences that will summarize your writing. Creation paper is a unique kind of writing. It may not meet all the requirements of the academic writing. But there are some aspects that you should pay your attention to. First of all, it concerns grammar, punctuation and spelling. So, try to avoid any mistakes while writing. Thus, keeping in mind this information will help you in writing your creation paper.
Wednesday, February 19, 2020
Robert Darnton's Peasants Tell Tales Essay Example | Topics and Well Written Essays - 500 words
Robert Darnton's Peasants Tell Tales - Essay Example In a piece of writing "Peasants Tell Tales" published in the New York Review of Books in February 1984 Darnton asserted that Europe's fairy tales presented an unusual door into "the mental world of the early modern peasantry", for the reason that those tales integrated centuries of peasant acuities. To Darnton, the fairy tales of Perrault plus the Grimms took on an influential new implication, due to their potential to imitate peasant worldviews and quick looks of lives lived in centuries past. Darnton further recommended in his article "Peasants Tell Tales" that French and German variant of the same storyline consistently measured national characteristics as well as national differences. The influence of Darnton's essay lay in his collection of familiar contentions on the subject of the origins and spread of fairy tales. Nineteenth-century postulations had turn into twentieth-century verities.
Tuesday, February 4, 2020
Marketing strategies analysis Case Study Example | Topics and Well Written Essays - 1000 words
Marketing strategies analysis - Case Study Example Despite this factor, it is also imperative to know that the company has retained and even accumulated a high number of customers that have remained loyal and this is owing to the appropriate customer service they get from the company and the long services that they get from these commodities. There are many existing opportunities for disruptive innovation in this particular market and Apex has really integrated them and thus come out as strengths.. All these developments receive appreciation and are recognized as milestones in the contemporary technology environment. It is important to understand that coming up with a new technological marketing device in the company, such as a watch, where it is directly connected to the phone, the operator can directly hear the conversation between the seller, and the buyer has it leading in its industry. The connection is in a manner that the user does not require to get into the pocket to communicate with the head office regarding the pricing but rather just presses some buttons on the device and talks freely is a bold move that can revolutionize the technology world. This one disruptive innovation will work effectively in the contemporary world. Another strength is regarding the fact that the company has earned many loyal customers over the years and thus it is difficult for other companies to attract them. Competitors are very critical in any business. In order to understand the weaknesses presented by the company, it is important to put oneself as one of the competitors and show the various ways the competitor can beat Apex due to its weakness. If tasked with the role of bringing up a rival company, an effective strategy would ensure that the strategy was quite different from that adopted by Apex Foods. As opposed to Apex Foodsââ¬â¢s strategy of marketing commodities to high-end customers only, the commodities produced would be of high
Monday, January 27, 2020
Green Fluorescent Protein (GFP) Mutants
Green Fluorescent Protein (GFP) Mutants GREEN FLUORESCENT PROTEIN (GFP) MUTANTS WITH ALTERED FLUORESCENCE INTENSITY AND EMMISSION SPECTRA Introduction: Now-a-days GFP is creating revolution in the field of science by its applications and properties.GFP is a stable protein extracted from the photo organs of the jellyfish Aequoria victoria by Shimomura et al in 1962. In 1992 the cloning of GFP has done. It is found in a variety of coelenterates (both hydrozoa and anthozoa) and it emits light by utilising energy from the Ca2+ activated photoprotein aequorin [1]. Energy transfer and the emission spectra of GFP can be affected by dimerization. Structure of GFP is cylindrical à ²-can structure and has a chromophore located centrally. The chromophore is responsible for the fluorescence and the formation is independent of species but mainly depends on oxygen. GFP is a small protein and has been made up of 238 amino acids. Deletion of any seven amino acids either from C-terminus or N-terminus may result in the loss of fluorescence. Amino acid replacement is responsible for the change in colours of GFP. It has a molecular weight of 27 KDa an d has an absorption range at 488 nm and an emission range at 509 nm. It can accomplish high temperatures (65 ÃÅ c) and basic PH range of 6-12 [2]. Increase in PH results in the decrease of fluorescence. Increase in the fluorescence and photo stability can be achieved by single point mutation at S65T. Fluorophore of the GFP is generated by using auto-catalytic process of continuous mechanisms. Visible excitation is one of the optical properties of GFP. Its derivatives are produced from the mutagenesis experiments like random and directed mutagenesis [3]. GFP is majorly used as a reporter in expressing genes. Protein and chromophore folding also constitutes as a major advantage of GFP. It can also be used in protein fusion by applying recombinant DNA technology. Aim of this research is to analyze properties of GFP by cloning, mutations, expression of proteins and purification. Objectives of this research are to sub-clone GFP into a vector and mutations are carried out by various mutagenesis experiments followed by expression of proteins and purification. Finally after purification properties are analyzed. Materials and methods: Initially DNA is isolated and GFPuv is sub-cloned into the pET28c vector from pET23 plasmid by speectrophotometric analysis. 5à µg of pET23GFPuv DNA is digested by using NdeI and HindIII restriction enzymes. And the digests are analysed by using Agarose gel electrophoresis. GFP fragment is extracted and purified using QIA quick gel extraction kit from QIAGEN and the recovered DNA is estimated. Recombinant protein is expressed in E.coli by ligation and transformation. To confirm the presence of GFP in the pET28c plasmid, colony PCR is used. Further mutagenesis experiments are carried out by designing oligonucleotide primers which will alter the spectral properties of the protein. Complementary primers containing same mutations are generated. Mutagenic primers are prepared with a melting temperature of âⰠ¥ 78à ºC, length between 25 and 45 bases and primers longer than 45 bases are generally used. Introduction and identification of mutations within GFPuv gene: Mutations are created in the GFPuv insert by site-directed mutagenesis Site-directed mutagenesis: 5à µl 10 x PCR buffer 5à µl 20 mM dNTP mixes 15 ng GFPuv-pET28c template DNA 125ng oligonucleotide primer F+ 125ng oligonucleotide primer R+ 2à µl 25mM MgSo4 32à µl sterile water 1à µl KOD hot start polymerase (1U/à µl) * All the above are added to 0.2ml PCR tubes and incubated in a PCR machine for 24 cycles: 94à ºC 30s 94à ºC 30s 55à ºC 1min 68à ºC 4min 20s 68à ºC 10 min * Reaction is then kept on ice for 2 min and 1à µl (1U) of Dpn1 is added and incubated for 60 min at 37à ºC Alignment of amino acid sequences is carried out using: http://www.ebi.ac.uk/Tools/clustalw2/index.html Product of site-directed mutagenesis (pET28c DNA) is transformed into XL-1 supercompetent cells. Transformed colonies are extracted using QIAprep Mini prep kit Qiagen [5]. Concentration and purity can be checked by using Agarose gel electrophoresis. For this 5à µl of plasmid preparation and 10U HindIII are digested at 37à ºC for 1h. Sequencing is then carried out by using 10à µl of DNA at a concentration of 50ng/à µl. E.coli BL21 (DE3) cells are prepared and are transformed into the pET28cGFPuv plasmid for expression Auto-induction method: Wild type protein (GFPuv) and the mutant protein are expressed in the expression vector [BL21 (DE3)] using auto-induction method. For this transformed colonies are inoculated into 3ml of LB-1D + antibiotic media and incubated at 37à ºC at 300 RPM for 6 hrs and O.D is taken. Inoculum is taken into the flask containing SB-5052 auto-induction medium along with antibiotic and incubated at 28à ºC at 300 RPM for 20 hrs. Cultures are then cooled for 1 hr. Total induced sample is prepared by taking 100à µl of cooling culture and 900à µl of SB-5052 media. Cells are then pelletized by centrifuging it with both total induced and non-induced samples and are resuspended in 100à µl of SDS-PAGE (sodium dodecyl sulphate (SDS) polyacrylamide gel electrophoresis(PAGE)) sample buffer. 12% of polyacrylamide gel is prepared and the Soluble and insoluble samples are prepared by cell fractionation using BUGBUSTER. For this 1à µl of DNAase1 is used along with reagents. Cell suspension is then centrifuged at 13000rpm for 20mins. Supernatant is then used as soluble sample and insoluble is prepared by resuspending the pellet in 2ml binding buffer. SDS-PAGE buffer and binding buffer are added to the soluble and insoluble fractions. At 95à ºC all samples are heated for 5 min. Gel is then loaded as: Molecular weight standard-5à µl Uninduced sample 5à µl Induced total sample 5à µl Soluble sample 5à µl Gel has to run for 1 hr. And is transfered to a box of Coomassie blue stain. Western blotting: GFP protein presence can be verified using western blotting technique. Protein samples are first seperated by SDS-PAGE and are transferred to the nitrocellulose membrane. GFP bound to nitrocellulose membrane is then visualised by incubating the blot with His-probe which is linked to a HRP (horse radish peroxidase) enzyme (HisprobeTM-HRP solution is diluted to 1:5000 (1à µl in 5ml) ). His-tag of GFP protein is bound to probe. Blots are kept in TBST and probes and thus probes are visualised by chemiluminescence and these are photographed by chemiluminescent reader. Ni-NTA chromatography: His tagged GFP can be purified by Ni-NTA (nickel nitrilo triacetic acid) chromatography method. In this, sample of soluble protein is loaded on column packed agarose resin and the non-specific protein binding is removed by washing resin with buffer and is eluted by high concentrated imidazole of elution buffer. After elution the purification of protein is done by SDS-PAGE and Coomassie staining. The concentration of the protein is measured by Bradford assay. Fluorimetry and mass spectrometry: Properties of GFPuv protein are analysed by Fluorimetry and mass spectroscopy. Fluorimetry: In this wavelength and intensity of a molecule at specific wavelength are measured using fluorimeters. Perkin Elmer LS50B is the fluorimeter used to measure GFP. Quartz cuvettes are placed in a chamber to measure the concentration and intensity. The parameters set to measure GFP are: Excitation 440nm Emission 460-550nm Slit widths 4 and 4 Accumulation 5 20à µg/ml of protein concentration is used. The emission and excitor wavelengths are set at 509nm and 395nm. Mass spectrometry: GFPuv properties and molecular mass can be analysed by mass spectroscopy. The type of mass spectroscopy used here is electron spray ionization (ESI). ESI is a type of atmospheric pressure ionisation technique (API) which is used for biochemical analysis. JEOL HX110/HX110A equipped with electron ion source tandem mass spectrometers are used to analyse structural properties [7]. 1-10 pmol/à µl of protein concentration is used. Solvents used are: MeOH MeCN TFA During ionisation sample is dissolved in a solvent and is pumped through a steel capillary at a rate of 1à µl/min and voltage of 3 or 4KV is applied [8]. Ion current is amplified by the detector and the data system will record signals in the form of mass spectrum. RESULTS: Site-directed mutagenesis: Primers used for site directed mutagenesis (Mutant) Forward primer: 5-CACTTGTCACTACTTTCTCTTGGGGTGTTCAATGCTTTTCC-3 Reverse primer: 5-GGAAAAGCATTGAACACCCCAAGAGAAAGTAGTGACAAGTG-3 Alignment of the amino acid sequence of the mutant with the GFPuv amino acid sequence GFPuv MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL 60 mGFPuv MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL 60 ************************************************************ GFPuv VTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV 120 mGFPuv VTTFSWGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV 120 *****:****************************************************** Y66W GFPuv NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLAD 180 mGFPuv NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLAD 180 ************************************************************ GFPuv HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK- 238 mGFPuv HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK- 238 ********************************************************** Amino acid substitution: Y66W Belongs to Class 5, indole in chromophore (cyan fluorescent proteins) [6] eCFP CATATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGAT 60 GFP ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGAT 57 ********************************************************* eCFP GGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATAC 120 GFP GGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATAC 117 ************************************************************ eCFP GGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACA 180 GFP GGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACA 177 ************************************************************ eCFP CTTGTCACTACTTTCTCTTGGGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAA 240 GFP CTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCATATGAAA 237 ******************* ******************************** ****** Mutation eCFP CGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT 300 GFP CGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT 297 ************************************************************ eCFP TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTT 360 GFP TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTT 357 ************************************************************ eCFP GTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACAC 420 GFP GTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACAC 417 ************************************************************ eCFP AAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAAT 480 GFP AAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAAT 477 ************************************************************ eCFP GGAATCAAAGCT 492 GFP GGAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGCA 537 ************ eCFP GFP GACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCAT 597 eCFP GFP TACCTGTCGACACAATCTGCCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTC 657 eCFP GFP CTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAATAA 717 SDS-PAGE : Coomassie staining gel of (Sample 6): Marker GFP protein (soluble sample) Western blotting (Sample 11): Induced total sample GFP protein Ni-NTA chromatography: Fluorimetry: Mass spectrometry: Wild-type: Mutant: Discussion: Site-directed mutagenesis: In the site-directed mutagenesis mutation is carried out at the right place i.e., at 197 and 198 places. Tyrosine (TAT) is mutated to tryptophan (TGG), Y W. During this mutation protein undergoes many changes especially in the fluorescence. GFP turns into CFP (Cyan fluorescent protein) hence the light emitted will not be exactly green. CFP will have many peculiar features like rather than single excitation and emission peaks it possess double humping. Tag CFP possess some properties like: Structure monomer Molecular weight 27KDa Polypeptide length 239aa Fluorescence colour Cyan Maximum excitation 458nm Maximum emission 480nm Excitation coefficient 37000M-1 cm-1 Pka 4.7 Quantum yield 0.57 Brightness 21.1 Brightness is produced by the quantum yield and extinction coefficient. Dual colour visualisation of the protein expressed is enabled by the CFP. This has led to the Fluorescence Resonance Energy Development (FRET). SDS-PAGE: SDS-PAGE is carried out to separate proteins according to their electrophoretic mobility and experimental repeats will result in the purity assessment of the protein. Four wells are loaded with samples and 2 and 4 wells show protein result and as 1 and 3 wells dont contain protein they will be normal without any bands. Results shows that little amount of GFP has been observed in the insoluble and large amount of protein has been observed in the soluble sample. Uninduced sample cannot find GFP. Western-blotting: Western-blot is performed to make sure the presence of protein. Histidine tagged probe is added to confirm the protein present was GFP or not. pET28c plasmid contains T7 RNA polymerase promoter sequence. But this promoter is blocked by the repressor. Hence lactose containing medium is required for E.coli growth. Because lactose is used as carbon source, glucose is converted into allolactose. This allolactose will bind to repressor by unblocking promoter, and expresses GFP. Hence presence of glucose will result in Lac-I and is binds to the operator. Band observed in the blot is probably GFP and it has high level of intensity after induction. And it is necessary to confirm this by performing blotting technique using His probe to detect His tagged GFP. Bands are observed in the induced and soluble samples after performing western blotting confirming the presence of GFP. Ni-NTA chromatography: Purification of GFP can be done by Ni-NTA chromatography. For a recombinant protein the amino acid binding site with 6 or more His residues in a row acts as metal binding site. So hexa-his sequence is called as His-tag. His-tag sequence is present in the N-terminal of the target protein and is located in the promoter region adjacently to the GFP gene. During this process enzyme HRP is also bound to the probe. This HRP-probe will react with luminal 4 peroxidase buffer which is further used for purifying GFP by Ni-NTA chromatography. Purification by His-tagged GFP can be done by using several methods like Ni2+-poly (2 acetomidoacrylic acid) hydrogel. Displacement of GFP can be done by binding nickel to imidazole. This is mainly because of high affinity of nickel towards imidazole compared to GFP.Distinctive bands are supposed to observe in the elute1, elute 2 and also in the total soluble fraction. Bands formed states the presence of the GFP mutant. Absence of the bands states mutant a bsence. In the results bands are observed at the total induced and the soluble samples which state the protein presence. Even small amounts of bands are also observed in the insoluble sample. GFP protein produced in the induced total sample is approximately at 27KDa. Slight bands are observed in the insoluble sample as it may be because of some impurities. Finally the GFP protein has been detected. References: 1. Davenport D, Nichol JAC: Luminescence in Hydromedusae. Proceedings of the Royal Society, Series B 1955, 144:399-411 2. Ward. W., Prentice, H., Roth, A. Cody. C. and Reeeves.S.1982.Spectral perturbations of the Aequoria green fluorescent protein. Photochem. Photobiol. 35:803-808 3. Cormack, B. P., Valdivia, R. H., Falkow, S. (1996). FACS-optimized mutants of the green fluorescent protein (GFP). Gene, In press 4. Darelle Thomson , Greg Smith. (2001).PCR-based plasmid vector construction for generation of recombinant viruses. Journal of Virological Methods 94, 7-14 5. Vogelstein, B., and Gillespie, D. (1979) Preparative and analytical purification of DNA from agarose. Proc. Natl. Acad. Sci. USA 76, 615-619. 6. HEIM, R., PRASHER, D. C. TSIEN, R. Y. 1994. Wavelength Mutations and Posttranslational Autoxidation of Green Fluorescent Protein. Proceedings of the National Academy of Sciences of the United States of America, 91, 12501-12504. 7. HARUKI NIWA, SATOSHI INOUYE et,al., Chemical nature of the light emitter of the Aequorea green fluorescent protein. Vol. 93, pp. 13617-13622, November 1996. Proc. Natl. Acad. Sci. USA. 8. ââ¬Å"Mass Spectrometry: A Foundation Courseâ⬠, K. Downard, Royal Society of Chemistry, UK, 2004.
Sunday, January 19, 2020
Foundation Certificate in Human Resource Practice Essay
1. Collecting and recording HR data is vitally important to an organisation. The collecting of the data could be to monitor that laws and regulations are being adhered to for example the Health and Safety at work act 1974, ensuring that all staff are maintaining high health and safety awareness and complying to the law. The data would need to be collected to enable the organisation to prove that it is adhering to current law and legislation. Another example could also be to monitor employee absence levels across the organisation and looking for any pattern or trend relating to individual absences. This data could be used in Absence review meetings and having all the correct and accurate data could be vital in a dispute with an employee. It could highlight issues with employee welfare and enable the company to offer support in order to support the employee back to work. 2. Storing Records There are many methods of storing records, an example is: Electronic which includes hard disks drive ââ¬â PC, CD ââ¬â recorder, DVD, databases and spreadsheets, internet or intranet, USB devices, emails and virtual learning environments. Electronic storage can have pros and cons. Advantages can be the speed and accuracy that it provides, spellcheckers etc can all help the documents to be stored accurately. Vast amounts of data can be stored on a computer software system and therefore not take up and physical office space. The electronic way of storing data can also be protected by a password meaning that it is secure and accurate at the same time and protected from anyone outside the HR function, and it means that a variety of colleagues can have access to update and amend the records at the same time, even updating at the same time as colleagues. Manual Storage. Manual storage can be personnel files, absence forms, reports, filing cabinets etc There are lots of benefits to manual storage including having documents which need a physical signature and provide proof of identity like bank details etc. Also should a computer system crash or wipe the documents the paper copy is always accessible. Manual storage is easy to move around and is easy to keep protected and confidential via a lock/key etc although staff with access must ensure it is securely locked away. 3. UK Legislation The Data Protection Act 1998 is about respecting individual rights when processing/collecting and storing their personal information. This is achievable for the company by being honest with employees about the use of their information and by following good data handling procedures. The act is compulsory and all organisations that hold or process personal data must adhere to this. Personal data should be processed fairly and lawfully, the data should be adequate, relevant and not excessive, it should be accurate and where necessary kept up to date, any data should not be kept for longer than necessary, data should be kept secure. All staff has responsibilities under the Act to ensure that their activities comply with the Data Protection Principles Employees do have a right legally to access information that an organisation may hold on them. This could include information regarding any grievances or disciplinary action, or information obtained through performance monitoring processes. Processes should be in place to deal with a data request from an employee as a 40 day time limit is compulsory. The health and safety at work at 1974 is legislation relating to protecting employees from injury or illness as a direct result of their job. All data relating to health and safety must be recorded and stored securely, including accident books. This data may be called upon many years after an employee has left the organisation so staff should ensure documents and information are kept in a secure adequate accessible place. The Freedom of Information Act which came into force in 2000 gives you the right to ask any public sector organisation for all the recorded information they have on any subject. Anyone can make a request for information ââ¬â there are no restrictions on your age, nationality or where you live. If you ask for information about yourself, then your request will be handled under the Data Protection Act 1998. Recording, Analysing and using Human Resources information is highly important and ensuring it is accurate and efficient will support the organisation strategy in many ways. The Analysis can change the way the organisation moves forward and affect future plans/decisions.
Saturday, January 11, 2020
Memorandum: Net Present Value and Apex Investment Partners
MEMORANDUM To Apex Investment Partners: According to my analysis of the Accesslineââ¬â¢s proposed term sheet, I do not believe that Apex would serve its own interests, or those of its investing partners, by investing in Accessline according to the terms proposed. By investing at the proposed valuation, according to the proposed control and incentive structure, Apex would be shouldering a disproportionate share of the risk should Accessline fail to meet its performance targets, or require fresh inflows of capital from future investment rounds.Nor can Accessline take the sort of steps necessary to protect its investment in the case of management failure. Should Apex make a counter-offer, I would suggest the following terms: Valuation: Accesslineââ¬â¢s projected revenues in 1999 are $208m. Using the average price/revenue ratio of 3com and Boston Technologies, it seems reasonable to expect an IPO valuation at 3. 67 times revenues, producing gross proceeds of $764m with a present va lue of $116m (using our 60% discount rate).Assuming that Accessline meets this revenue target, and that no future funding is required, Apex will take a slight loss on its required rate of return, barring the voluntary distribution of the dividend from the board of directors, on which we are not offered a seat. The present price per share at such an exit would be approximately $7. 84. However, given Accesslineââ¬â¢s historical burn rate, it seems unreasonable to expect the $16m investment produced in Series B to last Accessline until 1999.Assuming Accessline will need another $32m to reach its revenue targets by 1999, Apex takes a much more severe loss relative to its required rate of return. The present price per share at such an exit, assuming the new shares are also offered at $8 per share, would be $6. 18 per share. I therefore suggest using $6 per share as a point for a new valuation of the company, assuming the inclusion/revision of terms as described below. Rights and Prefe rences Apart from the valuation, other elements of the term sheet must be adjusted to allow Accessline to protect its interests and motivate or replace management in the case of performance failure.First and foremost, Apex must insist on the right to elect one director to the board. Series A investors already have one seat, and the current voting clauses allow Series A to effectively retain control of decision making by requiring 2/3rds majority for many key decisions. Should future funding rounds be required, those investors may insist on seats on the board. Apex must remove antidilution protection from employee shares, as this removes a significant incentive for employees and management to reduce Accesslineââ¬â¢s burn rate.However, as Series A investors retain a veto over the deal, their shares must be allowed to retain anti-dilution protection. Additionally, we may propose a point at which additional investment rounds (above and beyond $32m of fresh capital) would cause diluti on of ESOP shares at an accelerated rate. Dividends should be made cumulative and issuable upon a liquidation event or an IPO. Such dividends may be converted, if the holder desires, to common shares. This will encourage management to seek a quicker exit. Liquidation preference must be strengthened in other ways.In my opinion, the current arrangement allows management and employees to receive unjustified returns in the case of a liquidation. I suggest a ratio of 1. 5 times the Series B purchase price, applicable to Series A shares, with the remainder to be distributed among Series A, Series B, and common shareholders/ESOP on an as-if-converted basis. In an IPO, Series B shares should auto-convert at a ratio of one-to-one at a target price of $12 until June 30th and $15 after June 30th 1996. After that, the targets must continue to ratchet upwards.The written consent of 3/4ths of Preferred shareholders could override this requirement while preserving Apexââ¬â¢s ability to veto aut o-conversion. This voting ratio should also be employed in the voting clause, since without it Apex lacks any ability to control future funding rounds. Series B must be allowed to redeem all of their shares upon the failure of Accessline to come within 5% of its revenue and income projections for 2 consecutive years. Alternatively, Apex could require that unvested management/ESOP shares be returned to Series A and Series B on a pari passu basis in the case of performance failure.Alternatively, Accessline could insist on a right to replace management in the case of this eventuality. Given the large number of competitors already present in the market, it is likely that if Accesslineââ¬â¢s business fails, it will do so quickly and drastically. Negotiation considerations It is important to note that a counterproposal from Accessline that strengthens or enhances any of these provisions in Apexââ¬â¢ favor in exchange for a higher issue price of the Series B shares should be consider ed.However, there are limits to the premium we should pay for enhanced control, and firm limits for how far such control can be reduced. A board member and the voting rules are non-negotiable. The dividend and the autoconversion terms, however, are places in which we can demonstrate flexibility. At this price, with these changes to the term sheet, we are still exposed. Significant competitive, regulatory, or technological changes in the marketplace could quickly destroy Accesslineââ¬â¢s profitability.This is, as it stands, a strong counterproposal that is bound to meet resistance from management and employees, but provided we preserve Series Aââ¬â¢s valuation, I believe Series A investors will be inclined to allow us more control and latitude provided the performance requirements for management are strengthened. Since I believe our competitors will also propose lower valuations based on a view of these same numbers, we must act tactfully. Perhaps some sort of parachute can be arranged for senior management in the event of a takeover.
Thursday, January 2, 2020
The Philosophical Branch Of Personal Identity - 1884 Words
In the philosophical branch of personal identity there exist several approaches to the question what is it for the same person to exist over time. It is important to stress that we are referring to numerical identity here, i.e. the identity of a person over a period of time. What is it on the basis of which we say that a person on time point 1 is same as that on time point 2? In general, there exist three approaches to this question: the physical theories (the brain view and the body view), the brain and the bodily identity as the possible criterion of Personal Identity as well as the mental theory such as the psychological continuity view. The latter one determines that a person at an earlier and at a later time are the same person if and only if there is a continuous chain of overlapping direct psychological connections. In his paper ââ¬Å"The Self and the Futureâ⬠, Williams presents two thought experiments. The first one is a variation of John Lockeââ¬â¢s ââ¬Å"body swappingâ⬠thought experiment, the second one has the original characteristics of the first experiment but but results in the contrary conclusion to the one of the first experiment. In the first thought experience, person A and B exchange bodies which means that they have the sum of their memories and psychological characteristics transferred into one anotherââ¬â¢s bodies. By examining various scenarios where in each of them both persons are first asked whether A-body-person or B-body-person should receive a punishment or aShow MoreRelatedPhysics Of Quantum Mechanical Experiments1337 Words à |à 6 Pagescommunication. Particles seem not to take one path, not the other, not both, and not neither, and even act as if they ââ¬Å"knowâ⬠when weââ¬â¢re observing them.) In this final installment of a three-article series, weââ¬â¢ll look in very broad strokes at some of the philosophical implications of these views of quantum mechanics. I. Logic Standard logic is two-valued. That just means that each sentence in the logic is true or false, not both, and not neither. ââ¬ËMy catââ¬â¢s breath smells like cat foodââ¬â¢ is either true or false;Read MoreWhy Should Anyone Study Philosophy?1126 Words à |à 5 Pages Tameka Jonas Thompson Survey of Philosophical Thoughts Professor James Moore June 5, 2015 Why should anyone study philosophy? What is philosophy in the article by Alistair Sinclair philosophical is the study about knowledge, truth, nature and the meaning of life. People try to know themselves, the world, and relationships with the world and others. The word philosophy comes from the Greek Philos (loving) and Sophos (wise) meaning literally love of wisdom; a person that loves philosophyRead MoreMy Own Beliefs About Teaching And Learning Essay1679 Words à |à 7 Pagesto continuum chart in Part B). The branches of philosophy; which are metaphysics, epistemology, and axiology, are all related to how the world views various philosophies, including those of education, and learning theories. Metaphysics is the branch of philosophy that addresses questions of reality. An example of a question would be, ââ¬Å"What is reality?â⬠. In classrooms, teachers invoke metaphysical issues regularly when they make decisions about what and how they should teach and organize theirRead MoreImportance And Importance Of Philosophy1179 Words à |à 5 Pagesbreak into branches or subcategories of philosophy and study belief systems more intricately. It is important to study philosophy because philosophy can significantly further critical thinking skills by improving oneââ¬â¢s logic and ethics. The first branch of philosophy to note is social and political philosophy. Social and political philosophy together show the relationship between civilization and the betterment of human beings. The main task that social and political philosophy conquer is answeringRead MoreThe Relativism of Ethics2162 Words à |à 9 Pagesnot be considered moral or ethical in another social setting. A.J. Ayer argues that philosophical argument is unimportant because there is no such thing as universal ethics (Beckwith 67). The debate about ethics and morality has its basis in social construction. What is considered right or wrong is understood by the culture because of the rules of that culture. Normative ethics is the branch of philosophical thought which suggests that what is considered to be ethical is in fact nothing neitherRead MorePropelling Rational Thought Over Compelling Empiricism1459 Words à |à 6 Pagesfundamental empiricism of John Lockeââ¬â¢s philosophical arguments, in particular their ideas relating to the science of man, his identity and attempt to explain distinctions between the two. As I lay the framework of my argument it is important to understand the precepts that serve as the underpinning for the views considered by Descartes and Locke respectively. Rationalism and empiricism are two modes of thought that have been adopted within epistemology, the b ranch of philosophy devoted to studying theRead MoreExistentialism And How This Philosophical Theory Has Developed Over The Years1443 Words à |à 6 PagesAbstract: In this paper we hope to discuss existentialism and how this philosophical theory has developed over the years. After World War 2, this theory became increasingly popular and some of the great philosophers such as Freidrich Nietzsche, Soren Kierkegaard can be said to be the founders of this theory although they, in their lifetime, never accepted this. Therefore they are sometimes called precursors of this movement. Other major philosophers like Albert Camus, Jean-Paul Sartre and MartinRead MoreThe Theory Of Consciousness And The Body1847 Words à |à 8 Pagesthat individual, which would cause the apple to change from being an object to a subject. A girl enters a garden and a bird lands on a branch next to her. At that moment, she becomes consciousness of the fact that there is a bird across from her; she is now aware of the birdââ¬â¢s existence. The movements and sounds that the bird makes by going from branch to branch are events that grasp the girlââ¬â¢s attention of that moment and nothing else. But the process of her becoming aware of the bird is her perceptionRead MoreThe Most Powerful Learning Experiences For Me1624 Words à |à 7 Pages174), as well as welcome opinions which are contradictory or different from the majority. However, I have to admit that eliminating the influence of personal biases and values in working with diverse in-class groups turned out to be one of the most challenging aspects of my learning experience. I learned and understood how ââ¬Å"cultural identities powerfully influence how we view ourselves and how others view usâ⬠(Miley, Oââ¬ËMelia, Dubois, 2013, p. 33). As stated in Miley, Oââ¬ËMelia, and Dubois (2013)Read More Personal Identity and Psychological Reductionism Essay1943 Words à |à 8 PagesPersonal Identity and Psychological Reductionism When we tackle the question of What makes us the individual persons that we are?, one approach that we can take is to seek an answer to the question of what it is that is required for a person to continue to exist over time. If we could agree on what is required for it to be true that you continued to exist, then we would have good grounds to believe that we had discovered what makes someone the particular person they are, and by extension
Subscribe to:
Posts (Atom)